Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAPN5 monoclonal antibody (M02A), clone 3C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about CAPN5 monoclonal antibody (M02A), clone 3C10
| Brand: | Abnova |
| Reference: | H00000726-M02A |
| Product name: | CAPN5 monoclonal antibody (M02A), clone 3C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPN5. |
| Clone: | 3C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 726 |
| Gene name: | CAPN5 |
| Gene alias: | FLJ46245|HTRA3|nCL-3 |
| Gene description: | calpain 5 |
| Genbank accession: | NM_004055 |
| Immunogen: | CAPN5 (NP_004046, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNLQALHTLHLRDRNSRQPSN |
| Protein accession: | NP_004046 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CAPN5 monoclonal antibody (M02A), clone 3C10 Western Blot analysis of CAPN5 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |