| Brand:  | Abnova | 
| Reference:  | H00000721-M03 | 
| Product name:  | C4B monoclonal antibody (M03), clone 1F2 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant C4B. | 
| Clone:  | 1F2 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 721 | 
| Gene name:  | C4B | 
| Gene alias:  | C4A|C4A13|C4A91|C4B1|C4B12|C4B2|C4B3|C4B5|C4F|CH|CO4|CPAMD3|FLJ60561|MGC164979 | 
| Gene description:  | complement component 4B (Chido blood group) | 
| Genbank accession:  | NM_000592 | 
| Immunogen:  | C4B (NP_000583, 1347 a.a. ~ 1446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG | 
| Protein accession:  | NP_000583 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged C4B is 0.1 ng/ml as a capture antibody. | 
| Applications:  | IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |