No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA,WB-Re | 
| Brand: | Abnova | 
| Reference: | H00000718-M11 | 
| Product name: | C3 monoclonal antibody (M11), clone X1 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant C3. | 
| Clone: | X1 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 718 | 
| Gene name: | C3 | 
| Gene alias: | ARMD9|ASP|CPAMD1 | 
| Gene description: | complement component 3 | 
| Genbank accession: | NM_000064 | 
| Immunogen: | C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK | 
| Protein accession: | NP_000055 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Applications: | ELISA,WB-Re | 
| Shipping condition: | Dry Ice |