Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C3 monoclonal antibody (M01A), clone 5F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about C3 monoclonal antibody (M01A), clone 5F9
| Brand: | Abnova |
| Reference: | H00000718-M01A |
| Product name: | C3 monoclonal antibody (M01A), clone 5F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant C3. |
| Clone: | 5F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 718 |
| Gene name: | C3 |
| Gene alias: | ARMD9|ASP|CPAMD1 |
| Gene description: | complement component 3 |
| Genbank accession: | NM_000064 |
| Immunogen: | C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK |
| Protein accession: | NP_000055 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | C3 monoclonal antibody (M01A), clone 5F9 Western Blot analysis of C3 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |