C3 monoclonal antibody (M01), clone 5F9 View larger

C3 monoclonal antibody (M01), clone 5F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C3 monoclonal antibody (M01), clone 5F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about C3 monoclonal antibody (M01), clone 5F9

Brand: Abnova
Reference: H00000718-M01
Product name: C3 monoclonal antibody (M01), clone 5F9
Product description: Mouse monoclonal antibody raised against a partial recombinant C3.
Clone: 5F9
Isotype: IgG2a Kappa
Gene id: 718
Gene name: C3
Gene alias: ARMD9|ASP|CPAMD1
Gene description: complement component 3
Genbank accession: NM_000064
Immunogen: C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
Protein accession: NP_000055
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000718-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000718-M01-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to C3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy C3 monoclonal antibody (M01), clone 5F9 now

Add to cart