Brand: | Abnova |
Reference: | H00000717-M16 |
Product name: | C2 monoclonal antibody (M16), clone 4G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C2. |
Clone: | 4G8 |
Isotype: | IgG2a Lambda |
Gene id: | 717 |
Gene name: | C2 |
Gene alias: | CO2|DKFZp779M0311 |
Gene description: | complement component 2 |
Genbank accession: | NM_000063.3 |
Immunogen: | C2 (NP_000054.2, 21 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | APSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGR |
Protein accession: | NP_000054.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |