| Brand:  | Abnova | 
| Reference:  | H00000717-M15 | 
| Product name:  | C2 monoclonal antibody (M15), clone 2C11 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant C2. | 
| Clone:  | 2C11 | 
| Isotype:  | IgG2a Lambda | 
| Gene id:  | 717 | 
| Gene name:  | C2 | 
| Gene alias:  | CO2|DKFZp779M0311 | 
| Gene description:  | complement component 2 | 
| Genbank accession:  | NM_000063.3 | 
| Immunogen:  | C2 (NP_000054.2, 21 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | APSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGR | 
| Protein accession:  | NP_000054.2 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |