Cart 2 Product Products 919,20 € (empty)
No products
To be determined Shipping
919,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 919,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 919,20 €
Data sheet of C2 monoclonal antibody (M07), clone 7G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about C2 monoclonal antibody (M07), clone 7G1
| Brand: | Abnova |
| Reference: | H00000717-M07 |
| Product name: | C2 monoclonal antibody (M07), clone 7G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant C2. |
| Clone: | 7G1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 717 |
| Gene name: | C2 |
| Gene alias: | CO2|DKFZp779M0311 |
| Gene description: | complement component 2 |
| Genbank accession: | NM_000063.3 |
| Immunogen: | C2 (NP_000054.2, 21 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | APSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGR |
| Protein accession: | NP_000054.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |