View larger

C1QBP purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of C1QBP purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00000708-B01P
Product name:	C1QBP purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human C1QBP protein.
Gene id:	708
Gene name:	C1QBP
Gene alias:	GC1QBP\|HABP1\|SF2p32\|gC1Q-R\|gC1qR\|p32
Gene description:	complement component 1, q subcomponent binding protein
Genbank accession:	NM_001212
Immunogen:	C1QBP (NP_001203.1, 1 a.a. ~ 282 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Protein accession:	NP_001203.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of C1QBP expression in transfected 293T cell line (H00000708-T02) by C1QBP MaxPab polyclonal antibody. Lane 1: C1QBP transfected lysate(31.02 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ce,WB-Ti,IF,WB-Tr
Shipping condition:	Dry Ice