View larger

TSPO purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of TSPO purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00000706-B01P
Product name:	TSPO purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human TSPO protein.
Gene id:	706
Gene name:	TSPO
Gene alias:	BZRP\|DBI\|IBP\|MBR\|PBR\|PKBS\|PTBR\|mDRC\|pk18
Gene description:	translocator protein (18kDa)
Genbank accession:	BC001110.2
Immunogen:	TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Protein accession:	AAH01110.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of TSPO expression in transfected 293T cell line (H00000706-T01) by TSPO MaxPab polyclonal antibody. Lane 1: BZRP transfected lysate(18.59 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice