Brand: | Abnova |
Reference: | H00000701-M01 |
Product name: | BUB1B monoclonal antibody (M01), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BUB1B. |
Clone: | 2G9 |
Isotype: | IgG1 Kappa |
Gene id: | 701 |
Gene name: | BUB1B |
Gene alias: | BUB1beta|BUBR1|Bub1A|MAD3L|SSK1|hBUBR1 |
Gene description: | budding uninhibited by benzimidazoles 1 homolog beta (yeast) |
Genbank accession: | BC018739 |
Immunogen: | BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR |
Protein accession: | AAH18739 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1 ug/ml] |
Applications: | WB-Ti,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |