Brand: | Abnova |
Reference: | H00000699-M02A |
Product name: | BUB1 monoclonal antibody (M02A), clone 2F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BUB1. |
Clone: | 2F9 |
Isotype: | IgG1 Kappa |
Gene id: | 699 |
Gene name: | BUB1 |
Gene alias: | BUB1A|BUB1L|hBUB1 |
Gene description: | budding uninhibited by benzimidazoles 1 homolog (yeast) |
Genbank accession: | BC028201 |
Immunogen: | BUB1 (AAH28201, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA |
Protein accession: | AAH28201 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | BUB1 monoclonal antibody (M02A), clone 2F9 Western Blot analysis of BUB1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |