| Brand:  | Abnova | 
| Reference:  | H00000673-M02 | 
| Product name:  | BRAF monoclonal antibody (M02), clone 3D2 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant BRAF. | 
| Clone:  | 3D2 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 673 | 
| Gene name:  | BRAF | 
| Gene alias:  | B-RAF1|BRAF1|FLJ95109|MGC126806|MGC138284|RAFB1 | 
| Gene description:  | v-raf murine sarcoma viral oncogene homolog B1 | 
| Genbank accession:  | NM_004333 | 
| Immunogen:  | BRAF (NP_004324, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD | 
| Protein accession:  | NP_004324 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged BRAF is approximately 0.03ng/ml as a capture antibody. | 
| Applications:  | WB-Ti,S-ELISA,ELISA,WB-Re,PLA-Ce | 
| Shipping condition:  | Dry Ice | 
| Publications:  | An analysis of protein-protein interactions in cross-talk pathways reveals CRKL as a novel prognostic marker in hepatocellular carcinoma.Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY. Mol Cell Proteomics. 2013 Feb 8. [Epub ahead of print] |