No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00000673-M01 |
Product name: | BRAF monoclonal antibody (M01), clone 3C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BRAF. |
Clone: | 3C6 |
Isotype: | IgG1 Kappa |
Gene id: | 673 |
Gene name: | BRAF |
Gene alias: | B-RAF1|BRAF1|FLJ95109|MGC126806|MGC138284|RAFB1 |
Gene description: | v-raf murine sarcoma viral oncogene homolog B1 |
Genbank accession: | NM_004333 |
Immunogen: | BRAF (NP_004324, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD |
Protein accession: | NP_004324 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | BRAF monoclonal antibody (M01), clone 3C6 Western Blot analysis of BRAF expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |