| Brand: | Abnova |
| Reference: | H00000667-M02 |
| Product name: | DST monoclonal antibody (M02), clone 1D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DST. |
| Clone: | 1D2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 667 |
| Gene name: | DST |
| Gene alias: | BP240|BPA|BPAG1|CATX-15|D6S1101|DKFZp564B2416|DMH|DT|FLJ46791|KIAA0465|KIAA1470|MACF2 |
| Gene description: | dystonin |
| Genbank accession: | NM_183380 |
| Immunogen: | DST (NP_899236, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS |
| Protein accession: | NP_899236 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DST is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |