Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DST polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about DST polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000667-A01 |
| Product name: | DST polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DST. |
| Gene id: | 667 |
| Gene name: | DST |
| Gene alias: | BP240|BPA|BPAG1|CATX-15|D6S1101|DKFZp564B2416|DMH|DT|FLJ46791|KIAA0465|KIAA1470|MACF2 |
| Gene description: | dystonin |
| Genbank accession: | NM_183380 |
| Immunogen: | DST (NP_899236, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS |
| Protein accession: | NP_899236 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Evaluation of Contraceptive Potential of a Novel Epididymal Sperm Protein SFP2 in a Mouse Model.Khan SA, Jadhav SV, Suryawanshi AR, Bhonde GS, Gajbhiye RK, Khole VV. Am J Reprod Immunol. 2011 Jun 21. doi: 10.1111/j.1600-0897.2011.01030.x. |