| Brand: | Abnova |
| Reference: | H00000665-M01 |
| Product name: | BNIP3L monoclonal antibody (M01), clone 3G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BNIP3L. |
| Clone: | 3G2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 665 |
| Gene name: | BNIP3L |
| Gene alias: | BNIP3a|NIX |
| Gene description: | BCL2/adenovirus E1B 19kDa interacting protein 3-like |
| Genbank accession: | NM_004331 |
| Immunogen: | BNIP3L (NP_004322, 43 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE |
| Protein accession: | NP_004322 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged BNIP3L is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | BNIP3 and NIX Mediate Mieap-Induced Accumulation of Lysosomal Proteins within Mitochondria.Nakamura Y, Kitamura N, Shinogi D, Yoshida M, Goda O, Murai R, Kamino H, Arakawa H. PLoS One. 2012;7(1):e30767. Epub 2012 Jan 26. |