BNIP1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000662-D01P
Product name: BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human BNIP1 protein.
Gene id: 662
Gene name: BNIP1
Gene alias: NIP1|SEC20|TRG-8
Gene description: BCL2/adenovirus E1B 19kDa interacting protein 1
Genbank accession: NM_013978
Immunogen: BNIP1 (NP_053581.1, 1 a.a. ~ 194 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALRLFLATVLYIVKKRLFPFL
Protein accession: NP_053581.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000662-D01P-13-15-1.jpg
Application image note: Western Blot analysis of BNIP1 expression in transfected 293T cell line (H00000662-T03) by BNIP1 MaxPab polyclonal antibody.

Lane 1: BNIP1 transfected lysate(22.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BNIP1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart