| Brand: | Abnova |
| Reference: | H00000661-M01 |
| Product name: | POLR3D monoclonal antibody (M01), clone 4E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant POLR3D. |
| Clone: | 4E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 661 |
| Gene name: | POLR3D |
| Gene alias: | BN51T|RPC4|RPC53|TSBN51 |
| Gene description: | polymerase (RNA) III (DNA directed) polypeptide D, 44kDa |
| Genbank accession: | BC000516 |
| Immunogen: | POLR3D (-, 296 a.a. ~ 395 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH |
| Protein accession: | - |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged POLR3D is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |