View larger

BMPR1B monoclonal antibody (M07), clone 2E2

Reference:

Condition: New product

Data sheet of BMPR1B monoclonal antibody (M07), clone 2E2

Brand:	Abnova
Reference:	H00000658-M07
Product name:	BMPR1B monoclonal antibody (M07), clone 2E2
Product description:	Mouse monoclonal antibody raised against a partial recombinant BMPR1B.
Clone:	2E2
Isotype:	IgG2a Kappa
Gene id:	658
Gene name:	BMPR1B
Gene alias:	ALK-6\|ALK6\|CDw293
Gene description:	bone morphogenetic protein receptor, type IB
Genbank accession:	BC047773
Immunogen:	BMPR1B (AAH47773.1, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA
Protein accession:	AAH47773.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.07 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Mouse
Application image:
Application image note:	BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa ( Cat # L013V1 ).
Applications:	WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice