No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000656-M01A |
Product name: | BMP8B monoclonal antibody (M01A), clone 6D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BMP8B. |
Clone: | 6D6 |
Isotype: | IgG2a Kappa |
Gene id: | 656 |
Gene name: | BMP8B |
Gene alias: | BMP8|MGC131757|OP2 |
Gene description: | bone morphogenetic protein 8b |
Genbank accession: | NM_001720 |
Immunogen: | BMP8B (NP_001711, 274 a.a. ~ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV |
Protein accession: | NP_001711 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Gene expression of bone morphogenic protein 8B in the primary site, peripheral blood and bone marrow of patients with gastric cancer.Mima K, Fukagawa T, Kurashige J, Takano Y, Uchi R, Ueo H, Matsumura T, Ishibashi M, Sawada G, Takahashi Y, Akiyoshi S, Eguchi H, Sudo T, Sugimachi K, Watanabe M, Ishii H, Mori M, Baba H, Sasako M, Mimori K. ONCOLOGY LETTERS 6: 387-392, 2013 |