| Brand: | Abnova |
| Reference: | H00000655-M17 |
| Product name: | BMP7 monoclonal antibody (M17), clone 1E10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant BMP7. |
| Clone: | 1E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 655 |
| Gene name: | BMP7 |
| Gene alias: | OP-1 |
| Gene description: | bone morphogenetic protein 7 |
| Genbank accession: | NM_001719 |
| Immunogen: | BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET |
| Protein accession: | NP_001710 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |