BMP5 monoclonal antibody (M81), clone 2C9 View larger

BMP5 monoclonal antibody (M81), clone 2C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BMP5 monoclonal antibody (M81), clone 2C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about BMP5 monoclonal antibody (M81), clone 2C9

Brand: Abnova
Reference: H00000653-M81
Product name: BMP5 monoclonal antibody (M81), clone 2C9
Product description: Mouse monoclonal antibody raised against a partial recombinant BMP5.
Clone: 2C9
Isotype: IgG2a Kappa
Gene id: 653
Gene name: BMP5
Gene alias: MGC34244
Gene description: bone morphogenetic protein 5
Genbank accession: NM_021073.1
Immunogen: BMP5 (NP_066551.1, 323 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Protein accession: NP_066551.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000653-M81-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged BMP5 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy BMP5 monoclonal antibody (M81), clone 2C9 now

Add to cart