Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BMP5 monoclonal antibody (M30C), clone 4A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about BMP5 monoclonal antibody (M30C), clone 4A3
| Brand: | Abnova |
| Reference: | H00000653-M30C |
| Product name: | BMP5 monoclonal antibody (M30C), clone 4A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BMP5. |
| Clone: | 4A3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 653 |
| Gene name: | BMP5 |
| Gene alias: | MGC34244 |
| Gene description: | bone morphogenetic protein 5 |
| Genbank accession: | NM_021073.1 |
| Immunogen: | BMP5 (NP_066551.1, 341 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH |
| Protein accession: | NP_066551.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |