Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BLVRB monoclonal antibody (M09), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BLVRB monoclonal antibody (M09), clone 2F4
| Brand: | Abnova |
| Reference: | H00000645-M09 |
| Product name: | BLVRB monoclonal antibody (M09), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BLVRB. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 645 |
| Gene name: | BLVRB |
| Gene alias: | BVRB|FLR|MGC117413|SDR43U1 |
| Gene description: | biliverdin reductase B (flavin reductase (NADPH)) |
| Genbank accession: | NM_000713 |
| Immunogen: | BLVRB (NP_000704, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ |
| Protein accession: | NP_000704 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged BLVRB is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The heme degradation pathway is a promising serum biomarker source for the early detection of Alzheimer's disease.Mueller C, Zhou W, Vanmeter A, Heiby M, Magaki S, Ross MM, Espina V, Schrag M, Dickson C, Liotta LA, Kirsch WM. J Alzheimers Dis. 2010 Jan;19(3):1081-91. |