Brand: | Abnova |
Reference: | H00000645-A01 |
Product name: | BLVRB polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant BLVRB. |
Gene id: | 645 |
Gene name: | BLVRB |
Gene alias: | BVRB|FLR|MGC117413|SDR43U1 |
Gene description: | biliverdin reductase B (flavin reductase (NADPH)) |
Genbank accession: | NM_000713 |
Immunogen: | BLVRB (NP_000704, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ |
Protein accession: | NP_000704 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | BLVRB polyclonal antibody (A01), Lot # 060104JC01 Western Blot analysis of BLVRB expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |