BLVRB polyclonal antibody (A01) View larger

BLVRB polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BLVRB polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about BLVRB polyclonal antibody (A01)

Brand: Abnova
Reference: H00000645-A01
Product name: BLVRB polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant BLVRB.
Gene id: 645
Gene name: BLVRB
Gene alias: BVRB|FLR|MGC117413|SDR43U1
Gene description: biliverdin reductase B (flavin reductase (NADPH))
Genbank accession: NM_000713
Immunogen: BLVRB (NP_000704, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Protein accession: NP_000704
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000645-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000645-A01-1-9-1.jpg
Application image note: BLVRB polyclonal antibody (A01), Lot # 060104JC01 Western Blot analysis of BLVRB expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BLVRB polyclonal antibody (A01) now

Add to cart