Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 768,04 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 768,04 €
Data sheet of BLVRA monoclonal antibody (M01), clone 4G4-2B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BLVRA monoclonal antibody (M01), clone 4G4-2B6
| Brand: | Abnova |
| Reference: | H00000644-M01 |
| Product name: | BLVRA monoclonal antibody (M01), clone 4G4-2B6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant BLVRA. |
| Clone: | 4G4-2B6 |
| Isotype: | IgG2a kappa |
| Gene id: | 644 |
| Gene name: | BLVRA |
| Gene alias: | BLVR|BVR|BVRA |
| Gene description: | biliverdin reductase A |
| Genbank accession: | BC008456 |
| Immunogen: | BLVRA (AAH08456, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
| Protein accession: | AAH08456 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | BLVRA monoclonal antibody (M01), clone 4G4-2B6 Western Blot analysis of BLVRA expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |