BLVRA purified MaxPab mouse polyclonal antibody (B01P) View larger

BLVRA purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BLVRA purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IF,WB-Tr

More info about BLVRA purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000644-B01P
Product name: BLVRA purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human BLVRA protein.
Gene id: 644
Gene name: BLVRA
Gene alias: BLVR|BVR|BVRA
Gene description: biliverdin reductase A
Genbank accession: NM_000712.3
Immunogen: BLVRA (NP_000703.2, 1 a.a. ~ 296 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Protein accession: NP_000703.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000644-B01P-13-15-1.jpg
Application image note: Western Blot analysis of BLVRA expression in transfected 293T cell line (H00000644-T01) by BLVRA MaxPab polyclonal antibody.

Lane 1: BLVRA transfected lysate(32.56 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BLVRA purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart