Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 585,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 585,00 €
Data sheet of CXCR5 monoclonal antibody (M01), clone 2C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about CXCR5 monoclonal antibody (M01), clone 2C1
| Brand: | Abnova |
| Reference: | H00000643-M01 |
| Product name: | CXCR5 monoclonal antibody (M01), clone 2C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CXCR5. |
| Clone: | 2C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 643 |
| Gene name: | CXCR5 |
| Gene alias: | BLR1|CD185|MDR15|MGC117347 |
| Gene description: | chemokine (C-X-C motif) receptor 5 |
| Genbank accession: | NM_001716 |
| Immunogen: | CXCR5 (NP_001707, 1 a.a. ~ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP |
| Protein accession: | NP_001707 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged BLR1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |