CXCR5 monoclonal antibody (M01), clone 2C1 View larger

CXCR5 monoclonal antibody (M01), clone 2C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXCR5 monoclonal antibody (M01), clone 2C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CXCR5 monoclonal antibody (M01), clone 2C1

Brand: Abnova
Reference: H00000643-M01
Product name: CXCR5 monoclonal antibody (M01), clone 2C1
Product description: Mouse monoclonal antibody raised against a partial recombinant CXCR5.
Clone: 2C1
Isotype: IgG2a Kappa
Gene id: 643
Gene name: CXCR5
Gene alias: BLR1|CD185|MDR15|MGC117347
Gene description: chemokine (C-X-C motif) receptor 5
Genbank accession: NM_001716
Immunogen: CXCR5 (NP_001707, 1 a.a. ~ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP
Protein accession: NP_001707
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000643-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.16 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000643-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged BLR1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CXCR5 monoclonal antibody (M01), clone 2C1 now

Add to cart