Cart 2 Product Products 664,00 € (empty)
No products
To be determined Shipping
664,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 664,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 664,00 €
Data sheet of PRDM1 monoclonal antibody (M10), clone 1G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,ELISA,WB-Re |
More info about PRDM1 monoclonal antibody (M10), clone 1G9
| Brand: | Abnova |
| Reference: | H00000639-M10 |
| Product name: | PRDM1 monoclonal antibody (M10), clone 1G9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PRDM1. |
| Clone: | 1G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 639 |
| Gene name: | PRDM1 |
| Gene alias: | BLIMP1|MGC118922|MGC118923|MGC118924|MGC118925|PRDI-BF1 |
| Gene description: | PR domain containing 1, with ZNF domain |
| Genbank accession: | NM_001198 |
| Immunogen: | PRDM1 (NP_001189, 422 a.a. ~ 493 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHV |
| Protein accession: | NP_001189 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PRDM1 monoclonal antibody (M10), clone 1G9. Western Blot analysis of PRDM1 expression in human spleen. |
| Applications: | WB-Ti,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |