Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00000637-M01 |
Product name: | BID monoclonal antibody (M01), clone 3F3-1A3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant BID. |
Clone: | 3F3-1A3 |
Isotype: | IgG1 kappa |
Gene id: | 637 |
Gene name: | BID |
Gene alias: | FP497|MGC15319|MGC42355 |
Gene description: | BH3 interacting domain death agonist |
Genbank accession: | BC009197 |
Immunogen: | BID (AAH09197, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
Protein accession: | AAH09197 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (47.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of BID expression in transfected 293T cell line by BID monoclonal antibody (M01), clone 3F3-1A3. Lane 1: BID transfected lysate(22 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |