BID monoclonal antibody (M01), clone 3F3-1A3 View larger

BID monoclonal antibody (M01), clone 3F3-1A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BID monoclonal antibody (M01), clone 3F3-1A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce

More info about BID monoclonal antibody (M01), clone 3F3-1A3

Brand: Abnova
Reference: H00000637-M01
Product name: BID monoclonal antibody (M01), clone 3F3-1A3
Product description: Mouse monoclonal antibody raised against a full length recombinant BID.
Clone: 3F3-1A3
Isotype: IgG1 kappa
Gene id: 637
Gene name: BID
Gene alias: FP497|MGC15319|MGC42355
Gene description: BH3 interacting domain death agonist
Genbank accession: BC009197
Immunogen: BID (AAH09197, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Protein accession: AAH09197
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000637-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000637-M01-13-15-1.jpg
Application image note: Western Blot analysis of BID expression in transfected 293T cell line by BID monoclonal antibody (M01), clone 3F3-1A3.

Lane 1: BID transfected lysate(22 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy BID monoclonal antibody (M01), clone 3F3-1A3 now

Add to cart