| Brand: | Abnova |
| Reference: | H00000634-M02 |
| Product name: | CEACAM1 monoclonal antibody (M02), clone 2F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CEACAM1. |
| Clone: | 2F9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 634 |
| Gene name: | CEACAM1 |
| Gene alias: | BGP|BGP1|BGPI |
| Gene description: | carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) |
| Genbank accession: | BC014473 |
| Immunogen: | CEACAM1 (AAH14473, 305 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV |
| Protein accession: | AAH14473 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CEACAM1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |