CEACAM1 monoclonal antibody (M01), clone 2F10 View larger

CEACAM1 monoclonal antibody (M01), clone 2F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEACAM1 monoclonal antibody (M01), clone 2F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CEACAM1 monoclonal antibody (M01), clone 2F10

Brand: Abnova
Reference: H00000634-M01
Product name: CEACAM1 monoclonal antibody (M01), clone 2F10
Product description: Mouse monoclonal antibody raised against a partial recombinant CEACAM1.
Clone: 2F10
Isotype: IgG2a Kappa
Gene id: 634
Gene name: CEACAM1
Gene alias: BGP|BGP1|BGPI
Gene description: carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Genbank accession: BC014473
Immunogen: CEACAM1 (AAH14473, 305 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV
Protein accession: AAH14473
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000634-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CEACAM1 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CEACAM1 monoclonal antibody (M01), clone 2F10 now

Add to cart