Brand: | Abnova |
Reference: | H00000634-M01 |
Product name: | CEACAM1 monoclonal antibody (M01), clone 2F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CEACAM1. |
Clone: | 2F10 |
Isotype: | IgG2a Kappa |
Gene id: | 634 |
Gene name: | CEACAM1 |
Gene alias: | BGP|BGP1|BGPI |
Gene description: | carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) |
Genbank accession: | BC014473 |
Immunogen: | CEACAM1 (AAH14473, 305 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV |
Protein accession: | AAH14473 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CEACAM1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |