Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 174,99 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 174,99 €
Data sheet of BGN purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about BGN purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00000633-D01P |
| Product name: | BGN purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human BGN protein. |
| Gene id: | 633 |
| Gene name: | BGN |
| Gene alias: | DSPG1|PG-S1|PGI|SLRR1A |
| Gene description: | biglycan |
| Genbank accession: | NM_001711.3 |
| Immunogen: | BGN (NP_001702.1, 1 a.a. ~ 368 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
| Protein accession: | NP_001702.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BGN expression in transfected 293T cell line (H00000633-T01) by BGN MaxPab polyclonal antibody. Lane 1: BGN transfected lysate(41.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Structural remodeling of proteoglycans upon retinoic acid-induced differentiation of NCCIT cells.Gasimli L, Stansfield HE, Nairn AV, Liu H, Paluh JL, Yang B, Dordick JS, Moremen KW, Linhardt RJ. Glycoconj J. 2012 Oct 2. [Epub ahead of print] |