| Brand: | Abnova |
| Reference: | H00000632-A01 |
| Product name: | BGLAP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BGLAP. |
| Gene id: | 632 |
| Gene name: | BGLAP |
| Gene alias: | BGP|OC|PMF1 |
| Gene description: | bone gamma-carboxyglutamate (gla) protein |
| Genbank accession: | NM_199173 |
| Immunogen: | BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
| Protein accession: | NP_954642 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |