BDNF (Human) Recombinant Protein (P02) View larger

BDNF (Human) Recombinant Protein (P02)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BDNF (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about BDNF (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00000627-P02
Product name: BDNF (Human) Recombinant Protein (P02)
Product description: Human BDNF full-length ORF ( NP_733927.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 627
Gene name: BDNF
Gene alias: MGC34632
Gene description: brain-derived neurotrophic factor
Genbank accession: NM_170731.3
Immunogen sequence/protein sequence: MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Protein accession: NP_733927.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000627-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Convection enhanced drug delivery of BDNF through a microcannula in a rodent model to strengthen connectivity of a peripheral motor nerve bridge model to bypass spinal cord injury.Martin Bauknight W, Chakrabarty S, Hwang BY, Malone HR, Joshi S, Bruce JN, Sander Connolly E, Winfree CJ, Cunningham MG, Martin JH, Haque R.
J Clin Neurosci. 2012 Apr;19(4):563-9.

Reviews

Buy BDNF (Human) Recombinant Protein (P02) now

Add to cart