| Brand: | Abnova |
| Reference: | H00000624-M01 |
| Product name: | BDKRB2 monoclonal antibody (M01), clone 3F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BDKRB2. |
| Clone: | 3F6 |
| Isotype: | IgG1 lambda |
| Gene id: | 624 |
| Gene name: | BDKRB2 |
| Gene alias: | B2R|BK-2|BK2|BKR2|BRB2|DKFZp686O088 |
| Gene description: | bradykinin receptor B2 |
| Genbank accession: | NM_000623 |
| Immunogen: | BDKRB2 (NP_000614, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ |
| Protein accession: | NP_000614 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged BDKRB2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Development of antibody-modified chitosan nanoparticles for the targeted delivery of siRNA across the blood-brain barrier as a strategy for inhibiting HIV replication in astrocytes.Gu J, Al-Bayati K, Ho EA. Drug Deliv Transl Res. 2017 Mar 17.[Epub ahead of print] |