Cart 17 Product Products 5 274,10 € (empty)
No products
To be determined Shipping
5 274,10 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 274,10 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 274,10 €
Data sheet of BCS1L monoclonal antibody (M01), clone 5F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about BCS1L monoclonal antibody (M01), clone 5F3
| Brand: | Abnova |
| Reference: | H00000617-M01 |
| Product name: | BCS1L monoclonal antibody (M01), clone 5F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BCS1L. |
| Clone: | 5F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 617 |
| Gene name: | BCS1L |
| Gene alias: | BCS|BCS1|BJS|FLNMS|GRACILE|Hs.6719|PTD|h-BCS |
| Gene description: | BCS1-like (yeast) |
| Genbank accession: | NM_004328 |
| Immunogen: | BCS1L (NP_004319, 320 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLR |
| Protein accession: | NP_004319 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BCS1L expression in transfected 293T cell line by BCS1L monoclonal antibody (M01), clone 5F3. Lane 1: BCS1L transfected lysate(47.534 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Characterization of complex III deficiency and liver dysfunction in GRACILE syndrome caused by a BCS1L mutation.Kotarsky H, Karikoski R, Morgelin M, Marjavaara S, Bergman P, Zhang DL, Smet J, van Coster R, Fellman F. Mitochondrion (2010), doi:10.1016/ j.mito.2010.05.009 |