BCR monoclonal antibody (M01), clone 2E5 View larger

BCR monoclonal antibody (M01), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCR monoclonal antibody (M01), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce

More info about BCR monoclonal antibody (M01), clone 2E5

Brand: Abnova
Reference: H00000613-M01
Product name: BCR monoclonal antibody (M01), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant BCR.
Clone: 2E5
Isotype: IgG2a Kappa
Gene id: 613
Gene name: BCR
Gene alias: ALL|BCR-ABL1|BCR1|CML|D22S11|D22S662|FLJ16453|PHL
Gene description: breakpoint cluster region
Genbank accession: NM_004327
Immunogen: BCR (NP_004318.3, 182 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ
Protein accession: NP_004318.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000613-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000613-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged BCR is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy BCR monoclonal antibody (M01), clone 2E5 now

Add to cart