Brand: | Abnova |
Reference: | H00000608-M09 |
Product name: | TNFRSF17 monoclonal antibody (M09), clone 8B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF17. |
Clone: | 8B4 |
Isotype: | IgG2a Lambda |
Gene id: | 608 |
Gene name: | TNFRSF17 |
Gene alias: | BCM|BCMA|CD269 |
Gene description: | tumor necrosis factor receptor superfamily, member 17 |
Genbank accession: | BC058291.1 |
Immunogen: | TNFRSF17 (AAH58291.1, 5 a.a. ~ 50 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
Immunogen sequence/protein sequence: | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK |
Protein accession: | AAH58291.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |