> >>BAX polyclonal antibody (A02)
BAX polyclonal antibody (A02) View larger

BAX polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of BAX polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about BAX polyclonal antibody (A02)

Brand: Abnova
Reference: H00000581-A02
Product name: BAX polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant BAX.
Gene id: 581
Gene name: BAX
Gene alias: BCL2L4
Gene description: BCL2-associated X protein
Genbank accession: NM_138761
Immunogen: BAX (NP_620116, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Protein accession: NP_620116
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000581-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BAX polyclonal antibody (A02) now

Add to cart