| Brand: | Abnova |
| Reference: | H00000578-P01 |
| Product name: | BAK1 (Human) Recombinant Protein (P01) |
| Product description: | Human BAK1 full-length ORF ( NP_001179.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 578 |
| Gene name: | BAK1 |
| Gene alias: | BAK|BAK-LIKE|BCL2L7|CDN1|MGC117255|MGC3887 |
| Gene description: | BCL2-antagonist/killer 1 |
| Genbank accession: | NM_001188.3 |
| Immunogen sequence/protein sequence: | MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
| Protein accession: | NP_001179.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Systems Analysis of BCL2 Protein Family Interactions Establishes a Model to Predict Responses to Chemotherapy.Lindner AU, Concannon CG, Boukes GJ, Cannon MD, Llambi F, Ryan D, Boland K, Kehoe J, McNamara DA, Murray F, Kay EW, Hector S, Green DR, Huber HJ, Prehn JH. Cancer Res. 2013 Jan 15;73(2):519-28. doi: 10.1158/0008-5472.CAN-12-2269. |