BAK1 (Human) Recombinant Protein (P01) View larger

BAK1 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAK1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about BAK1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00000578-P01
Product name: BAK1 (Human) Recombinant Protein (P01)
Product description: Human BAK1 full-length ORF ( NP_001179.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 578
Gene name: BAK1
Gene alias: BAK|BAK-LIKE|BCL2L7|CDN1|MGC117255|MGC3887
Gene description: BCL2-antagonist/killer 1
Genbank accession: NM_001188.3
Immunogen sequence/protein sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Protein accession: NP_001179.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000578-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Systems Analysis of BCL2 Protein Family Interactions Establishes a Model to Predict Responses to Chemotherapy.Lindner AU, Concannon CG, Boukes GJ, Cannon MD, Llambi F, Ryan D, Boland K, Kehoe J, McNamara DA, Murray F, Kay EW, Hector S, Green DR, Huber HJ, Prehn JH.
Cancer Res. 2013 Jan 15;73(2):519-28. doi: 10.1158/0008-5472.CAN-12-2269.

Reviews

Buy BAK1 (Human) Recombinant Protein (P01) now

Add to cart