Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BAK1 monoclonal antibody (M01A), clone 1E4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,IP |
More info about BAK1 monoclonal antibody (M01A), clone 1E4
| Brand: | Abnova |
| Reference: | H00000578-M01A |
| Product name: | BAK1 monoclonal antibody (M01A), clone 1E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BAK1. |
| Clone: | 1E4 |
| Isotype: | IgM Kappa |
| Gene id: | 578 |
| Gene name: | BAK1 |
| Gene alias: | BAK|BAK-LIKE|BCL2L7|CDN1|MGC117255|MGC3887 |
| Gene description: | BCL2-antagonist/killer 1 |
| Genbank accession: | BC004431 |
| Immunogen: | BAK1 (AAH04431, 100 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
| Protein accession: | AAH04431 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of BAK1 transfected lysate using anti-BAK1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BAK1 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,IP |
| Shipping condition: | Dry Ice |