No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00000576-M01 |
| Product name: | BAI2 monoclonal antibody (M01), clone 6A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BAI2. |
| Clone: | 6A12 |
| Isotype: | IgG3 Kappa |
| Gene id: | 576 |
| Gene name: | BAI2 |
| Gene alias: | - |
| Gene description: | brain-specific angiogenesis inhibitor 2 |
| Genbank accession: | NM_001703 |
| Immunogen: | BAI2 (NP_001694, 22 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ |
| Protein accession: | NP_001694 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |