BAI2 polyclonal antibody (A01) View larger

BAI2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAI2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about BAI2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000576-A01
Product name: BAI2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant BAI2.
Gene id: 576
Gene name: BAI2
Gene alias: -
Gene description: brain-specific angiogenesis inhibitor 2
Genbank accession: NM_001703
Immunogen: BAI2 (NP_001694, 22 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
Protein accession: NP_001694
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000576-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000576-A01-2-A5-1.jpg
Application image note: BAI2 polyclonal antibody (A01). Western Blot analysis of BAI2 expression in human ovarian cancer.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BAI2 polyclonal antibody (A01) now

Add to cart