| Brand: | Abnova |
| Reference: | H00000546-M03 |
| Product name: | ATRX monoclonal antibody (M03), clone 5B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATRX. |
| Clone: | 5B3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 546 |
| Gene name: | ATRX |
| Gene alias: | ATR2|MGC2094|MRXHF1|RAD54|RAD54L|SFM1|SHS|XH2|XNP|ZNF-HX |
| Gene description: | alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) |
| Genbank accession: | NM_000489 |
| Immunogen: | ATRX (NP_000480, 2311 a.a. ~ 2410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILM |
| Protein accession: | NP_000480 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to ATRX on HeLa cell . [antibody concentration 20 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |