Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATR monoclonal antibody (M03), clone 1E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA |
More info about ATR monoclonal antibody (M03), clone 1E9
| Brand: | Abnova |
| Reference: | H00000545-M03 |
| Product name: | ATR monoclonal antibody (M03), clone 1E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATR. |
| Clone: | 1E9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 545 |
| Gene name: | ATR |
| Gene alias: | FRP1|MEC1|SCKL|SCKL1 |
| Gene description: | ataxia telangiectasia and Rad3 related |
| Genbank accession: | NM_001184 |
| Immunogen: | ATR (NP_001175, 2545 a.a. ~ 2644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM |
| Protein accession: | NP_001175 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ATR on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,ELISA |
| Shipping condition: | Dry Ice |