ATR monoclonal antibody (M01), clone 3F2 View larger

ATR monoclonal antibody (M01), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATR monoclonal antibody (M01), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ATR monoclonal antibody (M01), clone 3F2

Brand: Abnova
Reference: H00000545-M01
Product name: ATR monoclonal antibody (M01), clone 3F2
Product description: Mouse monoclonal antibody raised against a partial recombinant ATR.
Clone: 3F2
Isotype: IgG1 Kappa
Gene id: 545
Gene name: ATR
Gene alias: FRP1|MEC1|SCKL|SCKL1
Gene description: ataxia telangiectasia and Rad3 related
Genbank accession: NM_001184
Immunogen: ATR (NP_001175, 2545 a.a. ~ 2644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Protein accession: NP_001175
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000545-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000545-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ATR is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATR monoclonal antibody (M01), clone 3F2 now

Add to cart