| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000537-M02 |
| Product name: | ATP6AP1 monoclonal antibody (M02), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6AP1. |
| Clone: | 3B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 537 |
| Gene name: | ATP6AP1 |
| Gene alias: | 16A|ATP6IP1|ATP6S1|Ac45|CF2|MGC129781|VATPS1|XAP-3|XAP3 |
| Gene description: | ATPase, H+ transporting, lysosomal accessory protein 1 |
| Genbank accession: | NM_001183 |
| Immunogen: | ATP6AP1 (NP_001174, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE |
| Protein accession: | NP_001174 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M02), clone 3B11. Lane 1: ATP6AP1 transfected lysate (Predicted MW: 52 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |