Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00000533-D01P |
Product name: | ATP6V0B purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ATP6V0B protein. |
Gene id: | 533 |
Gene name: | ATP6V0B |
Gene alias: | ATP6F|HATPL|VMA16 |
Gene description: | ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b |
Genbank accession: | NM_004047.3 |
Immunogen: | ATP6V0B (NP_004038.1, 1 a.a. ~ 205 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD |
Protein accession: | NP_004038.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ATP6V0B expression in transfected 293T cell line (H00000533-T04) by ATP6V0B MaxPab polyclonal antibody. Lane 1: ATP6V0B transfected lysate(21.40 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |